Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMPA2, Human (His)

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IMPA2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/impa2-protein-human-his.html

Purity

98.0

Smiles

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Molecular Formula

3613 (Gene_ID) O14732-1 (M1-K288) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD320 (NM_016579) AAV Particle
RC200073A1V 250 µL

Human CD320 (NM_016579) AAV Particle

Sign In for Pricing
View Details
pOTB7-OSGEPL1-2 Plasmid
PVT26118 2 µg

pOTB7-OSGEPL1-2 Plasmid

Sign In for Pricing
View Details
Lentiviral mouse B4galt2 shRNA (UAS) - Lentiviral mouse B4galt2 shRNA (UAS) (100)
GTR15106182 1 Vial

Lentiviral mouse B4galt2 shRNA (UAS) - Lentiviral mouse B4galt2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Mouse AMY2A2 Protein, His (Fc)-Avi-tagged
AMY2A2-515M 50 µg

Recombinant Mouse AMY2A2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rabbit Prosaposin ELISA Kit
MBS724672-01 48 Well

Rabbit Prosaposin ELISA Kit

Sign In for Pricing
View Details
Rabbit Prosaposin ELISA Kit
MBS724672-02 96 Well

Rabbit Prosaposin ELISA Kit

Sign In for Pricing
View Details