Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Human

4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Human 4-1BB protein is a surface glycoprotein with a transmembrane domain (187-213 a.a.) . 4-1BB/TNFRSF9 Protein, Human is the extracellular part (E19-S184) of 4-1BB protein, produced by E. coli with tag free.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbr-tnfrsf9-protein-human.html

Purity

95.0

Smiles

ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS

Molecular Formula

3604 (Gene_ID) Q07011 (E19-S184) (Accession)

Molecular Weight

Approximately 17.7 kDa

References & Citations

[1]Wilcox RA, et al. Provision of antigen and CD137 signaling breaks immunological ignorance, promoting regression of poorly immunogenic tumors. J Clin Invest. 2002 Mar;109 (5) :651-9.|[2]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[3]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[4]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[5]Langstein J, et al. Comparative analysis of CD137 and LPS effects on monocyte activation, survival, and proliferation. Biochem Biophys Res Commun. 2000 Jun 24;273 (1) :117-22.|[6]Langstein J, et al. Identification of CD137 as a potent monocyte survival factor. J Leukoc Biol. 1999 Jun;65 (6) :829-33.|[7]Jiang D, et al. CD137 induces proliferation of murine hematopoietic progenitor cells and differentiation to macrophages. J Immunol. 2008 Sep 15;181 (6) :3923-32.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC eta (PRKCH) (NM_006255) Human Over-expression Lysate
LC401883 20 µg

PKC eta (PRKCH) (NM_006255) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS629077 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Pyrantel Pamoate
TRC-P840575-5G 5 g

Pyrantel Pamoate

Sign In for Pricing
View Details
IL17B Mouse Monoclonal Antibody [Clone ID: OTI8F7]
CF811134 100 µg

IL17B Mouse Monoclonal Antibody [Clone ID: OTI8F7]

Sign In for Pricing
View Details
GPR83 Mouse Monoclonal Antibody [Clone ID: OTI3E8]
CF811836 100 µg

GPR83 Mouse Monoclonal Antibody [Clone ID: OTI3E8]

Sign In for Pricing
View Details
Human TAS2R60 activation kit by CRISPRa
GA117370 1 Kit

Human TAS2R60 activation kit by CRISPRa

Sign In for Pricing
View Details