Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAU, Human (GST)

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

FAU Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fau-protein-human-gst.html

Purity

90.00

Smiles

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Molecular Formula

2197 (Gene_ID) P62861/NM_001997 (M1-S133) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria Gonorrhoeae rpsF Protein (aa 1-122)
VAng-Wyb2370-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rpsF Protein (aa 1-122)

Sign In for Pricing
View Details
MPP6 Protein Vector (Mouse) (pPM-C-HA)
PV201724 500 ng

MPP6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Skint1 ORF Vector (Mouse) (pORF)
ORF057355 1.0 µg DNA

Skint1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZNF307 (Zinc Finger Protein 307, Zinc Finger Protein 427, ZNF427, Zinc Finger Protein with KRAB and SCAN Domains 4, ZKSCAN4, P373c6.1)
135685 100 µg

ZNF307 (Zinc Finger Protein 307, Zinc Finger Protein 427, ZNF427, Zinc Finger Protein with KRAB and SCAN Domains 4, ZKSCAN4, P373c6.1)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human FAM241B (Family with sequence similarity 241 member B) Expressed in vitro E.coli expression system, Full Length
MPX1100K Each

Magic™ Membrane Protein Human FAM241B (Family with sequence similarity 241 member B) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor Subfamily A Member 3 (LILRA3) Protein
abx691434-01 20 µg

Human Leukocyte Immunoglobulin Like Receptor Subfamily A Member 3 (LILRA3) Protein

Sign In for Pricing
View Details