Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAU, Human (GST)

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

FAU Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fau-protein-human-gst.html

Purity

90.00

Smiles

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Molecular Formula

2197 (Gene_ID) P62861/NM_001997 (M1-S133) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CORO2A Antibody [Alexa Fluor 532]
NBP2-99188AF532 0.1 mL

Rabbit Polyclonal CORO2A Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
2'-Deoxyguanosine, monohydrate
DD0047 1g

2'-Deoxyguanosine, monohydrate

Sign In for Pricing
View Details
Mouse Monoclonal CD20 Antibody (rIGEL/773) [Alexa Fluor 488]
NBP2-54591AF488 100 µL

Mouse Monoclonal CD20 Antibody (rIGEL/773) [Alexa Fluor 488]

Sign In for Pricing
View Details
Hsa-miR-4470 miRNA Inhibitor
CIH1288-01 10 nmol

Hsa-miR-4470 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4470 miRNA Inhibitor
CIH1288-02 20 nmol

Hsa-miR-4470 miRNA Inhibitor

Sign In for Pricing
View Details
Lentiviral mouse Hmg20b shRNA (UAS) - Lentiviral mouse Hmg20b shRNA (UAS, RFP) plasmid
GTR15299584 1 Vial

Lentiviral mouse Hmg20b shRNA (UAS) - Lentiviral mouse Hmg20b shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details