Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAU, Human (GST)

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

FAU Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fau-protein-human-gst.html

Purity

90.00

Smiles

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Molecular Formula

2197 (Gene_ID) P62861/NM_001997 (M1-S133) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Matrix Gla Protein (MGP) ELISA Kit
MBS2703340-01 24 Strip Well

Rat Matrix Gla Protein (MGP) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Gla Protein (MGP) ELISA Kit
MBS2703340-02 48 Well

Rat Matrix Gla Protein (MGP) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Gla Protein (MGP) ELISA Kit
MBS2703340-03 96 Well

Rat Matrix Gla Protein (MGP) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Gla Protein (MGP) ELISA Kit
MBS2703340-04 5x 96 Well

Rat Matrix Gla Protein (MGP) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Gla Protein (MGP) ELISA Kit
MBS2703340-05 10x 96 Well

Rat Matrix Gla Protein (MGP) ELISA Kit

Sign In for Pricing
View Details
Anti-CDC25 (Phospho-S916) Antibody
CPA6228-01 30 µL

Anti-CDC25 (Phospho-S916) Antibody

Sign In for Pricing
View Details