Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAU, Human (GST)

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

FAU Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fau-protein-human-gst.html

Purity

90.00

Smiles

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Molecular Formula

2197 (Gene_ID) P62861/NM_001997 (M1-S133) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNA-Directed RNA Polymerase III Subunit RPC6 (POLR3F) ELISA Kit
abx382365 96 Tests

Human DNA-Directed RNA Polymerase III Subunit RPC6 (POLR3F) ELISA Kit

Sign In for Pricing
View Details
Rat Endonuclease G, Mitochondrial ELISA Kit (ENDOG)
RK03626 96 Tests

Rat Endonuclease G, Mitochondrial ELISA Kit (ENDOG)

Sign In for Pricing
View Details
TMBIM4 Protein Vector (Rat) (pPB-C-His)
PV311126 500 ng

TMBIM4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
FGF1 3'UTR GFP Stable Cell Line
TU057913 1.0 mL

FGF1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ipo4 (NM_024267) Mouse Tagged ORF Clone
MG220703 10 µg

Ipo4 (NM_024267) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Corynebacterium efficiens Dephospho-CoA kinase (coaE)
MBS1457923-01 0.02 mg (E-Coli)

Recombinant Corynebacterium efficiens Dephospho-CoA kinase (coaE)

Sign In for Pricing
View Details