Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (GST)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (GST) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-gst.html

Purity

90.00

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse LPO (Lactoperoxidase) Microsample ELISA Kit
ELK5221MS-01 48 Tests

Mouse LPO (Lactoperoxidase) Microsample ELISA Kit

Ask
View Details
Mouse LPO (Lactoperoxidase) Microsample ELISA Kit
ELK5221MS-02 96 Tests

Mouse LPO (Lactoperoxidase) Microsample ELISA Kit

Ask
View Details
Mouse LPO (Lactoperoxidase) Microsample ELISA Kit
ELK5221MS-03 5x 96 Tests

Mouse LPO (Lactoperoxidase) Microsample ELISA Kit

Ask
View Details
DNAJB4, CT (DnaJ homolog subfamily B member 4, Heat shock 40kD protein 1 homolog, HSP40 homolog, Heat shock protein 40 homolog, Human liver DnaJ-like protein, DNAJW, HLJ1)
350420-01 50 µL

DNAJB4, CT (DnaJ homolog subfamily B member 4, Heat shock 40kD protein 1 homolog, HSP40 homolog, Heat shock protein 40 homolog, Human liver DnaJ-like protein, DNAJW, HLJ1)

Ask
View Details
DNAJB4, CT (DnaJ homolog subfamily B member 4, Heat shock 40kD protein 1 homolog, HSP40 homolog, Heat shock protein 40 homolog, Human liver DnaJ-like protein, DNAJW, HLJ1)
350420-02 200 µL

DNAJB4, CT (DnaJ homolog subfamily B member 4, Heat shock 40kD protein 1 homolog, HSP40 homolog, Heat shock protein 40 homolog, Human liver DnaJ-like protein, DNAJW, HLJ1)

Ask
View Details
Omaveloxolone (RTA 408) 10mg
A14417-10 10 mg

Omaveloxolone (RTA 408) 10mg

Ask
View Details