Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peroxiredoxin-2/PRDX2, Human (His)

Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Peroxiredoxin-2/PRDX2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/peroxiredoxin-2-prdx2-protein-human-his.html

Smiles

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Molecular Formula

7001 (Gene_ID) P32119-1 (A2-N198) (Accession)

Molecular Weight

Approximately 25.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR9K2 (C-term) Rabbit Polyclonal Antibody
AP53113PU-N 400 µL

OR9K2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hsp75 (TRAP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA504224BM 100 µL

Hsp75 (TRAP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
FOXG1 Recombinant Rabbit monoclonal Antibody
HA751263 100 µL

FOXG1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse VCAM-1 protein (His tag)
PDMM100192-01 20 µg

Recombinant Mouse VCAM-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse VCAM-1 protein (His tag)
PDMM100192-02 100 µg

Recombinant Mouse VCAM-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse VCAM-1 protein (His tag)
PDMM100192-03 500 µg

Recombinant Mouse VCAM-1 protein (His tag)

Sign In for Pricing
View Details