Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peroxiredoxin-2/PRDX2, Human (His)

Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Peroxiredoxin-2/PRDX2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/peroxiredoxin-2-prdx2-protein-human-his.html

Smiles

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Molecular Formula

7001 (Gene_ID) P32119-1 (A2-N198) (Accession)

Molecular Weight

Approximately 25.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASP (Ab-290) Antibody
8B0597-AAT 50 µg

WASP (Ab-290) Antibody

Sign In for Pricing
View Details
Human WTIP activation kit by CRISPRa
GA114941 1 Kit

Human WTIP activation kit by CRISPRa

Sign In for Pricing
View Details
AATOM™ 532 acid
2820-AAT 10 mg

AATOM™ 532 acid

Sign In for Pricing
View Details
ACTN3 (Center) Rabbit Polyclonal Antibody
AP50072PU-N 400 µL

ACTN3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626741 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Cyclin B2 (X29.2), CF568 conjugate, 0.1mg/mL
BNC683059-500 1x 500 µL

Cyclin B2 (X29.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details