Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH5 Protein, Human (His-SUMO),Human,E. coli

Product Specifications

UNSPSC Description

The ITIH5 protein was identified as a potential tumor suppressor, indicating its critical role in controlling tumorigenesis. As a tumor suppressor, ITIH5 is expected to counteract uncontrolled cell growth and inhibit or regulate key pathways in tumor development. ITIH5 Protein, Human (His-SUMO) is the recombinant human-derived ITIH5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/itih5-protein-human-his-sumo.html

Purity

90.0

Smiles

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Meis homeobox 3 Antibody (OTI3E12)
NBP2-03933 0.1 mL

Mouse Monoclonal Meis homeobox 3 Antibody (OTI3E12)

Sign In for Pricing
View Details
Mouse Monoclonal TCP11L2 Antibody (OTI2A10) [PerCP]
NBP2-74477PCP 0.1 mL

Mouse Monoclonal TCP11L2 Antibody (OTI2A10) [PerCP]

Sign In for Pricing
View Details
G0S2 Rabbit Polyclonal Antibody
TA309667 50 µL

G0S2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL4 ELISA Kit
STJ150227 1 kit

Mouse IL4 ELISA Kit

Sign In for Pricing
View Details
Human Arylsulfatase D, ARSD ELISA KIT
ELI-11384h 96 Tests

Human Arylsulfatase D, ARSD ELISA KIT

Sign In for Pricing
View Details
Human Cathepsin B (CTSB) ELISA Kit
MBS2800366-01 48 Tests

Human Cathepsin B (CTSB) ELISA Kit

Sign In for Pricing
View Details