Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH5 Protein, Human (His-SUMO),Human,E. coli

Product Specifications

UNSPSC Description

The ITIH5 protein was identified as a potential tumor suppressor, indicating its critical role in controlling tumorigenesis. As a tumor suppressor, ITIH5 is expected to counteract uncontrolled cell growth and inhibit or regulate key pathways in tumor development. ITIH5 Protein, Human (His-SUMO) is the recombinant human-derived ITIH5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/itih5-protein-human-his-sumo.html

Purity

90.0

Smiles

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-Tyr-OtBu 10g
A23336-10000 10000 mg

Z-Tyr-OtBu 10g

Sign In for Pricing
View Details
Ruxolitinib sulfate 200mg
A11467-200 200 mg

Ruxolitinib sulfate 200mg

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Human qPCR Template Standard (NM_018677)
HK200546 1 Kit

Acetyl CoA synthetase (ACSS2) Human qPCR Template Standard (NM_018677)

Sign In for Pricing
View Details
Mouse Monoclonal RUNX3/CBFA3 Antibody (527327) [PE]
FAB3765P 0.1 mL

Mouse Monoclonal RUNX3/CBFA3 Antibody (527327) [PE]

Sign In for Pricing
View Details
Mouse Spryd4 qPCR Primer Pair
QM32542S 200 Tests

Mouse Spryd4 qPCR Primer Pair

Sign In for Pricing
View Details
Olr1695 Rat shRNA Lentiviral Particle (Locus ID 294159)
TL700098V 500 µL Each

Olr1695 Rat shRNA Lentiviral Particle (Locus ID 294159)

Sign In for Pricing
View Details