Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH5 Protein, Human (His-SUMO),Human,E. coli

Product Specifications

UNSPSC Description

The ITIH5 protein was identified as a potential tumor suppressor, indicating its critical role in controlling tumorigenesis. As a tumor suppressor, ITIH5 is expected to counteract uncontrolled cell growth and inhibit or regulate key pathways in tumor development. ITIH5 Protein, Human (His-SUMO) is the recombinant human-derived ITIH5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/itih5-protein-human-his-sumo.html

Purity

90.0

Smiles

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tyrosine Kinase ErbB-2 (146-192)
MBS147502-01 0.05 mg

Recombinant Human Tyrosine Kinase ErbB-2 (146-192)

Sign In for Pricing
View Details
Recombinant Human Tyrosine Kinase ErbB-2 (146-192)
MBS147502-02 0.1 mg

Recombinant Human Tyrosine Kinase ErbB-2 (146-192)

Sign In for Pricing
View Details
Recombinant Human Tyrosine Kinase ErbB-2 (146-192)
MBS147502-03 1 mg

Recombinant Human Tyrosine Kinase ErbB-2 (146-192)

Sign In for Pricing
View Details
Recombinant Human Tyrosine Kinase ErbB-2 (146-192)
MBS147502-04 5x 1 mg

Recombinant Human Tyrosine Kinase ErbB-2 (146-192)

Sign In for Pricing
View Details
Prostaglandin D2 serinol amide
HY-137483 1 mg

Prostaglandin D2 serinol amide

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CXE4 Polyclonal Antibody
MBS9006964 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CXE4 Polyclonal Antibody

Sign In for Pricing
View Details