Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-1 alpha/CCL3, Mouse (His)

MIP-1 alpha/CCL3 protein, a monokine, displays inflammatory, pyrogenic, and chemokinetic properties.It induces potent chemotaxis in eosinophils and activates calcium release in neutrophils via high-affinity receptor binding.Animal-Free MIP-1 alpha/CCL3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-1 alpha/CCL3 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-1 alpha/CCL3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-1-alpha-ccl3-protein-mouse-his.html

Purity

98.00

Smiles

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Molecular Formula

20302 (Gene_ID) P10855 (A24-A92) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANGE 2 - Supplementary shelf for cabinet 45 L
ES12J each

RANGE 2 - Supplementary shelf for cabinet 45 L

Sign In for Pricing
View Details
CDKN1A, CT (CDKN1A, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1, Cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, Melanoma differentiation-associated protein 6, p21) (AP) discontinued
030871-AP 100 µL

CDKN1A, CT (CDKN1A, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1, Cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, Melanoma differentiation-associated protein 6, p21) (AP) discontinued

Sign In for Pricing
View Details
Tris (1H,1H-heptafluorobutyl) phosphate
sc-331951A 5 g

Tris (1H,1H-heptafluorobutyl) phosphate

Sign In for Pricing
View Details
OPA3 Rabbit Polyclonal Antibody (AP)
orb965371 100 µL

OPA3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
ALDH3A1, Recombinant, Human (Aldehyde Dehydrogenase, Dimeric NADP-preferring, ALDHIII, Aldehyde Dehydrogenase 3, Aldehyde Dehydrogenase Family 3 Member A1, ALDH3)
A1334-33N1 20 µg

ALDH3A1, Recombinant, Human (Aldehyde Dehydrogenase, Dimeric NADP-preferring, ALDHIII, Aldehyde Dehydrogenase 3, Aldehyde Dehydrogenase Family 3 Member A1, ALDH3)

Sign In for Pricing
View Details
Recombinant Burkholderia vietnamiensis Membrane protein insertase YidC (yidC), partial
MBS7064126 Inquire

Recombinant Burkholderia vietnamiensis Membrane protein insertase YidC (yidC), partial

Sign In for Pricing
View Details