Question 1

What is the catalog number for JNK1 antibody?

Accepted Answer

The catalog number for JNK1 antibody is 70R-12562.

Question 2

What sizes are available for JNK1 antibody?

Accepted Answer

JNK1 antibody is available in the following size(s): 100 ul.

Question 3

Is JNK1 antibody in stock?

Accepted Answer

JNK1 antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

Can this product be used in multiplex assays?

Accepted Answer

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

Question 5

What happens if this product doesn’t perform as expected in my experiment?

Accepted Answer

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Question 6

Is this product classed as hazardous or restricted for shipping?

Accepted Answer

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

JNK1 antibody

Product Specifications

CAS Number

Frequently Asked Questions

Explore Other Products

Coronadiene

Lentiviral human NELFA sgRNA gene knockout kit - Lentiviral human NELFA sgRNA gene knockout kit (plasmid)

Mouse Rps6ka1 Antibody (C-term)

Mouse Rps6ka1 Antibody (C-term)

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH