Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AITRL/TNFSF18, Human

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR) . When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC) -activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1) [2]. AITRL/TNFSF18 Protein, Human is a recombinant human AITRL (E74-I198) without tag, which is expressed in E.coli.

Product Specifications

Product Name Alternative

AITRL/TNFSF18 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/aitrl-tnfsf18-protein-human.html

Purity

95.0

Smiles

METAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI

Molecular Formula

8995 (Gene_ID) Q9UNG2 (E52-I176) (Accession)

Molecular Weight

Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Park MS, et al. The association of the activation-inducible tumor necrosis factor receptor and ligand with lumbar disc herniation. Yonsei Med J. 2007 Oct 31;48 (5) :839-46.|[2]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[3]Lacal PM, et al. Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion. J Pharmacol Exp Ther. 2013 Oct;347 (1) :164-72.|[4]Wang F, et al. Structures of mouse and human GITR-GITRL complexes reveal unique TNF superfamily interactions. Nat Commun. 2021 Mar 2;12 (1) :1378.|[5]Placke T, et al. Glucocorticoid-induced TNFR-related (GITR) protein and its ligand in antitumor immunity: functional role and therapeutic modulation. Clin Dev Immunol. 2010;2010:239083.|[6]Tian J, et al. Increased GITRL Impairs the Function of Myeloid-Derived Suppressor Cells and Exacerbates Primary Sjögren Syndrome. J Immunol. 2019 Mar 15;202 (6) :1693-1703.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF647 conjugate, 0.1mg/mL
BNC470385-100 1x 100 µL

CD3e (Rabbit PAb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL
BNC470054-500 1x 500 µL

HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laminin (A5), CF640R conjugate, 0.1mg/mL
BNC400308-500 1x 500 µL

Laminin (A5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details