Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Kit ligand (KITLG), partial

Product Specifications

Product Name Alternative

Mast cell growth factor; MGF; Stem cell factor; SCF; c-Kit ligand; sKITLG

Abbreviation

Recombinant Bovine KITLG protein, partial

Gene Name

KITLG

UniProt

Q28132

Expression Region

26-215aa

Organism

Bos taurus (Bovine)

Target Sequence

QGICSNRVTDDVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYCIIDKLVKIVDDLVECMEEHSSENVKKSSKSPEPRQFTPEKFFGIFNKSIDAFKDLEIVASKMSECVISSTSSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIEDSSLQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Stimulates the proliferation of mast cells. Able to augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. Mediates also cell-cell adhesion. Acts synergistically with other cytokines, probably interleukins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-500 1x 500 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details