Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-glucuronidase/GUSB, E.coli (N-His, solution)

The beta-glucuronidase/GUSB protein displays activity with PNPG and 4-methylumbelliferyl-glucuronide. It scavenges glucuronate from various xenobiotic and endobiotic glucuronides in the GI tract, utilizing diverse carbon sources. As part of the GI microbiome, it can reactivate glucuronide drug conjugates, potentially harming the GI tract. Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution) is the recombinant E. coli-derived Beta-glucuronidase/GUSB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-glucuronidase-gusb-protein-e-coli-his.html

Purity

98.00

Smiles

MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ

Molecular Formula

946149 (Gene_ID) P05804 (M1-Q603) (Accession)

Molecular Weight

69-78 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thallos AM - green fluorescent thallium indicator
1381F 10x 50 µg

Thallos AM - green fluorescent thallium indicator

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (NM_000224) Human Over-expression Lysate
LC400083 20 µg

Cytokeratin 18 (KRT18) (NM_000224) Human Over-expression Lysate

Sign In for Pricing
View Details
HHLA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D12]
TA811165BM 100 µL

HHLA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D12]

Sign In for Pricing
View Details
2-epi-Moxidectin
TRC-M744805-5MG 5 mg

2-epi-Moxidectin

Sign In for Pricing
View Details
Recombinant NR5A2 Antibody
RC-15195-01 50 μL

Recombinant NR5A2 Antibody

Sign In for Pricing
View Details
Recombinant NR5A2 Antibody
RC-15195-02 100 µL

Recombinant NR5A2 Antibody

Sign In for Pricing
View Details