Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-glucuronidase/GUSB, E.coli (N-His, solution)

The beta-glucuronidase/GUSB protein displays activity with PNPG and 4-methylumbelliferyl-glucuronide. It scavenges glucuronate from various xenobiotic and endobiotic glucuronides in the GI tract, utilizing diverse carbon sources. As part of the GI microbiome, it can reactivate glucuronide drug conjugates, potentially harming the GI tract. Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution) is the recombinant E. coli-derived Beta-glucuronidase/GUSB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-glucuronidase-gusb-protein-e-coli-his.html

Purity

98.00

Smiles

MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ

Molecular Formula

946149 (Gene_ID) P05804 (M1-Q603) (Accession)

Molecular Weight

69-78 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryo-Protection Safety Kit Plus - MidArm
TS-SK-MAM-WP42GR 1 Kit

Cryo-Protection Safety Kit Plus - MidArm

Sign In for Pricing
View Details
PYROXD1 Antibody - N-terminal region : FITC (ARP71489_P050-FITC)
ARP71489_P050-FITC 100 µL

PYROXD1 Antibody - N-terminal region : FITC (ARP71489_P050-FITC)

Sign In for Pricing
View Details
Human RALB activation kit by CRISPRa
GA104011 1 Kit

Human RALB activation kit by CRISPRa

Sign In for Pricing
View Details
CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI11F7]
TA808229 100 µL

CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI11F7]

Sign In for Pricing
View Details
CCNG1 Conjugated Antibody
orb1617036 100 µL

CCNG1 Conjugated Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS619637 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details