Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-glucuronidase/GUSB, E.coli (N-His, solution)

The beta-glucuronidase/GUSB protein displays activity with PNPG and 4-methylumbelliferyl-glucuronide. It scavenges glucuronate from various xenobiotic and endobiotic glucuronides in the GI tract, utilizing diverse carbon sources. As part of the GI microbiome, it can reactivate glucuronide drug conjugates, potentially harming the GI tract. Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution) is the recombinant E. coli-derived Beta-glucuronidase/GUSB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-glucuronidase-gusb-protein-e-coli-his.html

Purity

98.00

Smiles

MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ

Molecular Formula

946149 (Gene_ID) P05804 (M1-Q603) (Accession)

Molecular Weight

69-78 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant KLC1 Antibody
RC-16688-01 50 μL

Recombinant KLC1 Antibody

Sign In for Pricing
View Details
Recombinant KLC1 Antibody
RC-16688-02 100 µL

Recombinant KLC1 Antibody

Sign In for Pricing
View Details
Recombinant KLC1 Antibody
RC-16688-03 1 mL

Recombinant KLC1 Antibody

Sign In for Pricing
View Details
PNMA8B (NM_020709) Human Recombinant Protein
TP313508M 100 µg

PNMA8B (NM_020709) Human Recombinant Protein

Sign In for Pricing
View Details
Human ABHD13 activation kit by CRISPRa
GA113789 1 Kit

Human ABHD13 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Muscle tissue
CB548943 1 Block

Frozen Tissue Blocks, Muscle tissue

Sign In for Pricing
View Details