Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLOC1S2, Human (N-GST)

BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

BLOC1S2 Protein, Human (N-GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Purity

97.00

Smiles

MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR

Molecular Formula

282991 (Gene_ID) Q6QNY1-2 (M1-R99) (Accession)

Molecular Weight

Approximately 34 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

D-dimer Antibody
ND-R0254 1 Each

D-dimer Antibody

Ask
View Details
Lentiviral human KRT82 sgRNA gene knockout kit - Lentiviral human KRT82 sgRNA gene knockout kit (25)
GTR15359196 1 Vial

Lentiviral human KRT82 sgRNA gene knockout kit - Lentiviral human KRT82 sgRNA gene knockout kit (25)

Ask
View Details
THAP11 Rabbit Polyclonal Antibody
AP55315SU-N 200 µL

THAP11 Rabbit Polyclonal Antibody

Ask
View Details
Doublecortin (DCX) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A3]
TA501778BM 100 µL

Doublecortin (DCX) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A3]

Ask
View Details
4-[ (3,4-dihydro-2H-1,5-benzodioxepin-7-ylsulfonyl) amino]benzoic acid
sc-348581A 1 g

4-[ (3,4-dihydro-2H-1,5-benzodioxepin-7-ylsulfonyl) amino]benzoic acid

Ask
View Details