Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLOC1S2, Human (N-GST)

BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

BLOC1S2 Protein, Human (N-GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Purity

97.00

Smiles

MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR

Molecular Formula

282991 (Gene_ID) Q6QNY1-2 (M1-R99) (Accession)

Molecular Weight

Approximately 34 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)
MBS1222714-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)

Ask
View Details
Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)
MBS1222714-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)

Ask
View Details
Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)
MBS1222714-03 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)

Ask
View Details
Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)
MBS1222714-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)

Ask
View Details
Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)
MBS1222714-05 0.02 mg (Baculovirus)

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)

Ask
View Details
Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)
MBS1222714-06 1 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Non-specific lipid-transfer protein 3 (LTP110-A)

Ask
View Details