BLOC1S2, Human (N-GST)
BLOC1S2 is an essential component of the BLOC-1 complex and is critical for the biogenesis of lysosome-related organelles (LROs), including platelet dense granules and melanosomes. BLOC-1 cooperates with the AP-3 complex to direct membrane protein cargo into vesicles for delivery to neurites and nerve terminals, suggesting that it is involved in neurite extension. BLOC1S2 Protein, Human (N-GST) is the recombinant human-derived BLOC1S2 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
BLOC1S2 Protein, Human (N-GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Purity
97.00
Smiles
MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Molecular Formula
282991 (Gene_ID) Q6QNY1-2 (M1-R99) (Accession)
Molecular Weight
Approximately 34 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
