Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement Factor D/Adipsin, Mouse (HEK293, His)

Complement Factor D/Adipsin Protein cleaves factor B in complex with factor C3b, activating the C3bbb complex to form the C3 convertase in the alternate pathway, analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Complement Factor D/Adipsin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-factor-d-adipsin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS

Molecular Formula

11537 (Gene_ID) P03953-1 (I26-S259) (Accession)

Molecular Weight

40-49 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Tag Antibody - HRP Conjugated
OAIA00169-1MG 1 mg

E-Tag Antibody - HRP Conjugated

Sign In for Pricing
View Details
Nlk Mouse shRNA Plasmid (Locus ID 18099)
TR501483 1 Kit

Nlk Mouse shRNA Plasmid (Locus ID 18099)

Sign In for Pricing
View Details
Cab39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6703407 1.0 µg DNA

Cab39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CK II alpha Recombinant Antibody, Biotin Conjugated
bsm-61133R-Biotin-TR 20 µL

CK II alpha Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PTK2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1752306 1.0 µg DNA

PTK2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human SAA2
MBS7621276-01 0.01 mg

Recombinant Human SAA2

Sign In for Pricing
View Details