Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-33 protein (Il33), partial (Active)

Product Specifications

Product Name Alternative

IL-33, ; Interleukin-33109-266, ]

Abbreviation

Recombinant Mouse Il33 protein, partial (Active)

Gene Name

Il33

UniProt

Q8BVZ5

Expression Region

109-266aa

Organism

Mus musculus (Mouse)

Target Sequence

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 106 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, and 1 mM EDTA

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; FUNCTION

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf77 Protein Vector (Human) (pPB-N-His)
PV065902 500 ng

C17orf77 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Protein A-HRP
MBS675012-01 1 mL

Protein A-HRP

Sign In for Pricing
View Details
Protein A-HRP
MBS675012-02 5x 1 mL

Protein A-HRP

Sign In for Pricing
View Details
COL6A3 ORF Vector (Human) (pORF)
ORF017596 1.0 µg DNA

COL6A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
AP2S1 Antibody
DF7883-01 100 µL

AP2S1 Antibody

Sign In for Pricing
View Details
AP2S1 Antibody
DF7883-02 200 µL

AP2S1 Antibody

Sign In for Pricing
View Details