Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL24/Eotaxin-2, Human

CCL24/Eotaxin-2 Protein, Human is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Human is a recombinant human CCL24/Eotaxin-2 (V27-A104) protein expressed by E. coli[1].

Product Specifications

Product Name Alternative

CCL24/Eotaxin-2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-human.html

Purity

98.0

Smiles

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA

Molecular Formula

6369 (Gene_ID) O00175 (V27-A104) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[2]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[3]Andrew Menzies-Gow, et al. Eotaxin (CCL11) and eotaxin-2 (CCL24) induce recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions following cutaneous injection in human atopic and nonatopic volunteers. J Immunol. 2002 Sep 1;169 (5) :2712-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGMT Polyclonal Antibody
MBS2547523-01 0.02 mL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
MBS2547523-02 0.06 mL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
MBS2547523-03 0.12 mL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
MBS2547523-04 0.2 mL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
MBS2547523-05 5x 0.2 mL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MUC1 Antibody [mFluor Violet 500 SE]
NBP1-60046MFV500 0.1 mL

Rabbit Polyclonal MUC1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details