Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Human (Biotinylated, HEK293, His)

B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Human (Biotinylated, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-biotinylated-239a-a-hek293-his.html

Purity

98.0

Smiles

LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDH

Molecular Formula

942 (Gene_ID) P42081-1 (L26-H245) (Accession)

Molecular Weight

Approximately 26.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DAD1 Antibody [Alexa Fluor 750]
NBP1-77197AF750 0.1 mL

Rabbit Polyclonal DAD1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Sau96 I unit: 300
YRSAU96 1 Vial

Sau96 I unit: 300

Sign In for Pricing
View Details
Syntaxin 12 HDR Plasmid (m)
sc-430311-HDR 20 µg

Syntaxin 12 HDR Plasmid (m)

Sign In for Pricing
View Details
SOD (Cu/Zn) Antibody: HRP
MBS805329-01 0.1 mg

SOD (Cu/Zn) Antibody: HRP

Sign In for Pricing
View Details
SOD (Cu/Zn) Antibody: HRP
MBS805329-02 5x 0.1 mg

SOD (Cu/Zn) Antibody: HRP

Sign In for Pricing
View Details
DES Antibody
orb1556084-01 50 μL

DES Antibody

Sign In for Pricing
View Details