Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST, Human (HEK293, His)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (HEK293, His) is the recombinant human-derived SOST protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOST Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sost-protein-human-hek-293-his.html

Purity

98.0

Smiles

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Molecular Formula

50964 (Gene_ID) Q9BQB4-1 (Q24-Y213) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-3,3,3-trifluoro-2- (2-methylphenyl) propanoic acid
RDC43425-01 50 mg

2-Amino-3,3,3-trifluoro-2- (2-methylphenyl) propanoic acid

Sign In for Pricing
View Details
2-Amino-3,3,3-trifluoro-2- (2-methylphenyl) propanoic acid
RDC43425-02 0.5 g

2-Amino-3,3,3-trifluoro-2- (2-methylphenyl) propanoic acid

Sign In for Pricing
View Details
GAB1 Human Recombinant Protein
TP725128 50 µg

GAB1 Human Recombinant Protein

Sign In for Pricing
View Details
Ndufs6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
31666116 3x 1.0 µg

Ndufs6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Croton Oil
sc-204698 10 g

Croton Oil

Sign In for Pricing
View Details
PHPT1 Rabbit pAb
E45R20171N-100 100 µL

PHPT1 Rabbit pAb

Sign In for Pricing
View Details