Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease T2 (RNASET2)

Product Specifications

Product Name Alternative

Ribonuclease 6

Abbreviation

Recombinant Human RNASET2 protein

Gene Name

RNASET2

UniProt

O00584

Expression Region

25-256aa

Organism

Homo sapiens (Human)

Target Sequence

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Ribonuclease that plays an essential role in innate immune response by recognizing and degrading RNAs from microbial pathogens that are subsequently sensed by TLR8 (PubMed:31778653) . Cleaves preferentially single-stranded RNA molecules between purine and uridine residues, which critically contributes to the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides (PubMed:31778653) . In turn, RNase T2 degradation products promote the RNA-dependent activation of TLR8 (PubMed:31778653) . Plays also a key role in degradation of mitochondrial RNA and processing of non-coding RNA imported from the cytosol into mitochondria (PubMed:28730546, PubMed:30184494) . Participates as well in degradation of mitochondrion-associated cytosolic rRNAs.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.1 kDa

References & Citations

"Structure and activity of the only human RNase T2." Thorn A., Steinfeld R., Ziegenbein M., Grapp M., Hsiao H.H., Urlaub H., Sheldrick G.M., Gartner J., Kratzner R. Nucleic Acids Res. 40:8733-8742 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSL1 Antibody
MBS7114302-01 0.05 mg

NSL1 Antibody

Sign In for Pricing
View Details
NSL1 Antibody
MBS7114302-02 0.1 mg

NSL1 Antibody

Sign In for Pricing
View Details
NSL1 Antibody
MBS7114302-03 5x 0.1 mg

NSL1 Antibody

Sign In for Pricing
View Details
Rabbit Anti-RUNX2 antibody
SL1134R-01 50 µL

Rabbit Anti-RUNX2 antibody

Sign In for Pricing
View Details
Rabbit Anti-RUNX2 antibody
SL1134R-02 100 µL

Rabbit Anti-RUNX2 antibody

Sign In for Pricing
View Details
PBDE 204
TRC-P215235-25MG 25 mg

PBDE 204

Sign In for Pricing
View Details