Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE)

Product Specifications

Product Name Alternative

(ManNAc-6-P epimerase)

Abbreviation

Recombinant Clostridium perfringens nanE protein

Gene Name

NanE

UniProt

Q8XNZ3

Expression Region

1-221aa

Organism

Clostridium perfringens (strain 13 / Type A)

Target Sequence

MLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDILK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Converts N-acetylmannosamine-6-phosphate (ManNAc-6-P) to N-acetylglucosamine-6-phosphate (GlcNAc-6-P) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.1 kDa

References & Citations

"Structural and functional characterization of the Clostridium perfringens N-acetylmannosamine-6-phosphate 2-epimerase essential for the sialic acid salvage pathway." Pelissier M.C., Sebban-Kreuzer C., Guerlesquin F., Brannigan J.A., Bourne Y., Vincent F. J Biol Chem 289:35215-35224 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-100 1x 100 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details