Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 beta protein (IL1B), partial

Product Specifications

Product Name Alternative

(IL-1 beta) (Catabolin)

Abbreviation

Recombinant Human IL1B protein, partial

Gene Name

IL1B

UniProt

P01584

Expression Region

117-269aa

Organism

Homo sapiens (Human)

Target Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells . Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6 .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

References & Citations

"Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs."March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDPK1 pSer241 Rabbit Polyclonal Antibody
AP02307PU-S 50 µL

PDPK1 pSer241 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
E-AB-66884-01 60 µL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
E-AB-66884-02 120 µL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
E-AB-66884-03 200 µL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
NUDT2 (NM_147173) Human Over-expression Lysate
LY403446 100 µg

NUDT2 (NM_147173) Human Over-expression Lysate

Sign In for Pricing
View Details
SYCE1L Human Gene Knockout Kit (CRISPR)
KN425306 1 Kit

SYCE1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details