Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Mouse (HEK293, His)

The CD150/SLAMF1 protein is an autoligand receptor in the SLAM family that complexly regulates the activation and differentiation of immune cells and is critical for innate and adaptive immune responses. CD150/SLAMF1 exhibits unique signaling in T lymphocytes and B cells through fine-tuning of cytoplasmic adapter proteins including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-slamf1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP

Molecular Formula

27218 (Gene_ID) Q9QUM4-1 (T25-P242) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF (NM_000601) Human Over-expression Lysate
LY400200 100 µg

HGF (NM_000601) Human Over-expression Lysate

Sign In for Pricing
View Details
Fast Plus EvaGreen® qPCR Master Mix with high Rox (500 rxn)
#31015-1 5x 1 mL

Fast Plus EvaGreen® qPCR Master Mix with high Rox (500 rxn)

Sign In for Pricing
View Details
Human FAM178B activation kit by CRISPRa
GA109678 1 Kit

Human FAM178B activation kit by CRISPRa

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/2940R), Biotin conjugate, 0.1mg/mL
BNCB2940-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/2940R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAK2 Mouse Monoclonal Antibody [Clone ID: 3B5]
AM06347SU-N 100 µL

PAK2 Mouse Monoclonal Antibody [Clone ID: 3B5]

Sign In for Pricing
View Details
AF4 (AFF1) Human Gene Knockout Kit (CRISPR)
KN417054 1 Kit

AF4 (AFF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details