Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Mouse (HEK293, His)

The CD150/SLAMF1 protein is an autoligand receptor in the SLAM family that complexly regulates the activation and differentiation of immune cells and is critical for innate and adaptive immune responses. CD150/SLAMF1 exhibits unique signaling in T lymphocytes and B cells through fine-tuning of cytoplasmic adapter proteins including SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-slamf1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP

Molecular Formula

27218 (Gene_ID) Q9QUM4-1 (T25-P242) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Deoxy-2-fluoro-D-glucose
TRC-D234500-10MG 10 mg

2-Deoxy-2-fluoro-D-glucose

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins
AAF-006-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins

Sign In for Pricing
View Details
SHARPIN (NM_030974) Human Recombinant Protein
TP322012 20 µg

SHARPIN (NM_030974) Human Recombinant Protein

Sign In for Pricing
View Details
PX 866
SIH-471-5MG 5 mg

PX 866

Sign In for Pricing
View Details
ERK1 (MAPK3) Human Gene Knockout Kit (CRISPR)
KN204196 1 Kit

ERK1 (MAPK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-(1H-indol-5-yl)propanoic acid
TRC-I628288-10MG 10 mg

3-(1H-indol-5-yl)propanoic acid

Sign In for Pricing
View Details