Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6D (Ly6d)

Product Specifications

Product Name Alternative

Ly-6D; Thymocyte B-cell antigen; ThB

Abbreviation

Recombinant Mouse Ly6d protein

Gene Name

Ly6d

UniProt

P35459

Expression Region

21-98aa

Organism

Mus musculus (Mouse)

Target Sequence

LRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVS

Tag

C-terminal mFc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8B Human Gene Knockout Kit (CRISPR)
KN415505 1 Kit

CD8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
T1A-2 (N-term) Rabbit Polyclonal Antibody
AP11877PU-N 400 µL

T1A-2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD37 (NM_001774) Human Recombinant Protein
TP762501 50 µg

CD37 (NM_001774) Human Recombinant Protein

Sign In for Pricing
View Details
FKBPL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]
TA502165BM 100 µL

FKBPL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Mouse Gja3 activation kit by CRISPRa
GA201613 1 Kit

Mouse Gja3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Smoc1 activation kit by CRISPRa
GA206432 1 Kit

Mouse Smoc1 activation kit by CRISPRa

Sign In for Pricing
View Details