Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6D (Ly6d)

Product Specifications

Product Name Alternative

Ly-6D; Thymocyte B-cell antigen; ThB

Abbreviation

Recombinant Mouse Ly6d protein

Gene Name

Ly6d

UniProt

P35459

Expression Region

21-98aa

Organism

Mus musculus (Mouse)

Target Sequence

LRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVS

Tag

C-terminal mFc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Cathepsin S/CTSS Protein (His Tag)
PKSM040493 50 µg

Recombinant Mouse Cathepsin S/CTSS Protein (His Tag)

Sign In for Pricing
View Details
Imazalil Sulfate
TRC-I268500-250MG 250 mg

Imazalil Sulfate

Sign In for Pricing
View Details
CHD7 Human Gene Knockout Kit (CRISPR)
KN421060 1 Kit

CHD7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS625505 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
BMPR1B Human Gene Knockout Kit (CRISPR)
KN210218RB 1 Kit

BMPR1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB523241 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details