Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase PGAM5, mitochondrial (PGAM5), partial

Product Specifications

Product Name Alternative

Bcl-XL-binding protein v68; Phosphoglycerate mutase family member 5

Abbreviation

Recombinant Human PGAM5 protein, partial

Gene Name

PGAM5

UniProt

Q96HS1

Expression Region

30-289aa

Organism

Homo sapiens (Human)

Target Sequence

KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression. Acts as a central mediator for programmed necrosis induced by TNF, by reactive oxygen species and by calcium ionophore.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Cadherin-17 Antibody (029) [CoraFluor 1]
NBP2-89891CL1 0.1 mL

Rabbit Monoclonal Cadherin-17 Antibody (029) [CoraFluor 1]

Sign In for Pricing
View Details
Mouse Dhx32 activation kit by CRISPRa
GA211646 1 Kit

Mouse Dhx32 activation kit by CRISPRa

Sign In for Pricing
View Details
B9d2 Rat shRNA Plasmid (Locus ID 308443)
TL706050 1 Kit

B9d2 Rat shRNA Plasmid (Locus ID 308443)

Sign In for Pricing
View Details
HIST1H2AJ Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV791810 1.0 µg DNA

HIST1H2AJ Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
LOXL4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV712004 1.0 µg DNA

LOXL4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Hsp60 Mouse mAb
GB14098-50 50 μL

Anti-Hsp60 Mouse mAb

Sign In for Pricing
View Details