Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine distemper virus Protein C (P/V/C)

Product Specifications

Abbreviation

Recombinant Canine distemper virus P/V/C protein

Gene Name

P/V/C

UniProt

P06941

Expression Region

1-174aa

Organism

Canine distemper virus (strain Onderstepoort) (CDV)

Target Sequence

MSAKGWNASKPSERILLTLRRFKRSAASETKPATQAKRMEPQACRKRRTLRISMNHTSQQKDQTMSAMYLKIIRDVENAILRLWRRSGPLERTSNQDLEYDVIMFMITAVKRLRESKMLTVSWYLQALSVIEDSREEKEALMIALRILAKIIPKEMLHLTGDILSALNRTEQLM

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.3 kDa

References & Citations

"Cloning and sequence analysis of tetanus toxin gene." Shumin Z., Dianliang L. Submitted (JUN-2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,7-Bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) pyrene
sc-485819 1 g

2,7-Bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) pyrene

Sign In for Pricing
View Details
ST6GAL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2295007 1.0 µg DNA

ST6GAL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PSMA5 Protein Vector (Human) (pPB-N-His)
PV056750 500 ng

PSMA5 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human Aconitase 1 (ACO1) ELISA Kit
RD-ACO1-Hu-96Tests 96 Tests

Human Aconitase 1 (ACO1) ELISA Kit

Sign In for Pricing
View Details
Fibrillarin (B-1) Alexa Fluor® 790
sc-166001 AF790 200 µg/mL

Fibrillarin (B-1) Alexa Fluor® 790

Sign In for Pricing
View Details
Rabbit Polyclonal ANKRD16 Antibody
NBP1-84178 0.1 mL

Rabbit Polyclonal ANKRD16 Antibody

Sign In for Pricing
View Details