Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTF, Mouse

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Mouse is produced by E. coli (A2-M198) with tag free.

Product Specifications

Product Name Alternative

CNTF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cntf-protein-mouse.html

Purity

95.00

Smiles

AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM

Molecular Formula

12803 (Gene_ID) P51642 (A2-M198) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[2]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[3]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[4]Holm NR, et al. CNTF inhibits high voltage activated Ca2+ currents in fetal mouse cortical neurones. J Neurochem. 2002 Aug;82 (3) :495-503.|[5]Watt MJ, et al. CNTF reverses obesity-induced insulin resistance by activating skeletal muscle AMPK. Nat Med. 2006 May;12 (5) :541-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opipramol-d4
018799 1 mg

Opipramol-d4

Sign In for Pricing
View Details
Anti-Cathepsin L Antibody, Rabbit Polyclonal
MBS8110776-01 0.1 mL

Anti-Cathepsin L Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cathepsin L Antibody, Rabbit Polyclonal
MBS8110776-02 5x 0.1 mL

Anti-Cathepsin L Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
ALAD siRNA (Human)
CRH0145-01 15 nmol

ALAD siRNA (Human)

Sign In for Pricing
View Details
ALAD siRNA (Human)
CRH0145-02 30 nmol

ALAD siRNA (Human)

Sign In for Pricing
View Details
(±) -Menthol
QAA35670-01 250 mg

(±) -Menthol

Sign In for Pricing
View Details