Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCD, Human (P.pastoris, His)

The DCD protein is found in sweat and has antimicrobial activity against Escherichia coli, Enterococcus faecalis, Staphylococcus aureus, and Candida albicans. DCD Protein, Human (P.pastoris, His) is the recombinant human-derived DCD protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

DCD Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcd-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Molecular Formula

117159 (Gene_ID) P81605-1 (Y20-L110) (Accession)

Molecular Weight

Approximately 17 kDa. The reducing (R) protein migrat es as 17 kDa in SDS-PAGE may be due to relative charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fin bud initiation factor homolog (HRP)
316093-01 50 µg

Fin bud initiation factor homolog (HRP)

Sign In for Pricing
View Details
Fin bud initiation factor homolog (HRP)
316093-02 100 µg

Fin bud initiation factor homolog (HRP)

Sign In for Pricing
View Details
B1R/BDKRB1 Antibody
orb1534504 50 µg

B1R/BDKRB1 Antibody

Sign In for Pricing
View Details
SOD2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-52741R-BF750-TR 20 µL

SOD2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
EVX1 (NM_001989) Human Tagged Lenti ORF Clone
RC214211L2 10 µg

EVX1 (NM_001989) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Basic FGF Rabbit mAb
F0933-100uL*2 2x 100 μL

Basic FGF Rabbit mAb

Sign In for Pricing
View Details