Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Mouse (His)

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html

Purity

95.0

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 17.25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1E) -1-[4- (cyclopentylsulfonyl) phenyl]ethanone oxime
sc-345282 250 mg

(1E) -1-[4- (cyclopentylsulfonyl) phenyl]ethanone oxime

Sign In for Pricing
View Details
Anti-FIGLA Antibody
CQA7523-01 30 µL

Anti-FIGLA Antibody

Sign In for Pricing
View Details
Anti-FIGLA Antibody
CQA7523-02 50 μL

Anti-FIGLA Antibody

Sign In for Pricing
View Details
Anti-FIGLA Antibody
CQA7523-03 100 µL

Anti-FIGLA Antibody

Sign In for Pricing
View Details
Anti-FIGLA Antibody
CQA7523-04 200 µL

Anti-FIGLA Antibody

Sign In for Pricing
View Details
Sumf1 3'UTR GFP Stable Cell Line
TU271404 1.0 mL

Sumf1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details