Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Mouse (His)

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html

Purity

95.0

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 17.25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decorin Antibody / DCN
V4308-20UG 20 µg

Decorin Antibody / DCN

Sign In for Pricing
View Details
Mouse Monoclonal Beta-endorphin Antibody (SPM501) - Azide and BSA Free
NBP2-54325-100ug 100 µg

Mouse Monoclonal Beta-endorphin Antibody (SPM501) - Azide and BSA Free

Sign In for Pricing
View Details
Aluminum Test Tube Basket 6 x 6 x 6
HS20341A 1 Each

Aluminum Test Tube Basket 6 x 6 x 6

Sign In for Pricing
View Details
Anti-Glutathione-S-Transferase (GST) Antibody, HRP conjugate
18844P-1 100 µg

Anti-Glutathione-S-Transferase (GST) Antibody, HRP conjugate

Sign In for Pricing
View Details
2-Naphthyl-α- L-fucopyranoside (β-Naphthyl-α-L-fucoside)
N-110-100-100mg 100 mg

2-Naphthyl-α- L-fucopyranoside (β-Naphthyl-α-L-fucoside)

Sign In for Pricing
View Details
PNU-74654
BML-WN101-0005 5 mg

PNU-74654

Sign In for Pricing
View Details