Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Mouse (His)

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html

Purity

95.0

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 17.25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICP Multi Elem (4) Calib Std Test 200.7 in 5% HNO3 1% HF - 100ML
REICPCAL4M 100 mL

ICP Multi Elem (4) Calib Std Test 200.7 in 5% HNO3 1% HF - 100ML

Sign In for Pricing
View Details
Gucy1a1 (NM_021896) Mouse Tagged ORF Clone
MG210068 10 µg

Gucy1a1 (NM_021896) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRNAN31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
68584111 3x 1.0 µg

TRNAN31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Feline Immunodeficiency Virus Envelope Antibody
GWB-AD4CD5 0.2 mg

Feline Immunodeficiency Virus Envelope Antibody

Sign In for Pricing
View Details
RAVER1, NT (RAVER1, KIAA1978, Ribonucleoprotein PTB-binding 1, Protein raver-1) (Azide free) (HRP)
MBS6340546-01 0.2 mL

RAVER1, NT (RAVER1, KIAA1978, Ribonucleoprotein PTB-binding 1, Protein raver-1) (Azide free) (HRP)

Sign In for Pricing
View Details
RAVER1, NT (RAVER1, KIAA1978, Ribonucleoprotein PTB-binding 1, Protein raver-1) (Azide free) (HRP)
MBS6340546-02 5x 0.2 mL

RAVER1, NT (RAVER1, KIAA1978, Ribonucleoprotein PTB-binding 1, Protein raver-1) (Azide free) (HRP)

Sign In for Pricing
View Details