Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Mouse (His)

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html

Purity

95.0

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 17.25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF10 qPCR Primer Pair
QH24957S 200 Tests

Human ZNF10 qPCR Primer Pair

Sign In for Pricing
View Details
FNIP1 Antibody, Biotin conjugated
A61607-50UG 50 µg

FNIP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
G3bp1 sgRNA CRISPR Lentivector set (Mouse)
K4610801 3x 1.0 µg

G3bp1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Trh (Prothyroliberin) ELISA Kit
EM2205 96 Tests

Mouse Trh (Prothyroliberin) ELISA Kit

Sign In for Pricing
View Details
Chicken Melatonin Sulfate ELISA Kit
MBS7275268-01 48 Well

Chicken Melatonin Sulfate ELISA Kit

Sign In for Pricing
View Details
Chicken Melatonin Sulfate ELISA Kit
MBS7275268-02 96 Well

Chicken Melatonin Sulfate ELISA Kit

Sign In for Pricing
View Details