Animal-Free CD70, Mouse (His)
The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html
Purity
95.0
Smiles
QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Molecular Formula
21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)
Molecular Weight
Approximately 17.25 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
TRNAL17 sgRNA CRISPR Lentivector (Human) (Target 3)
Lentiviral mouse Atp5b shRNA (UAS) - Lentiviral mouse Atp5b shRNA (UAS) plasmid
Lentiviral mouse Nup43 shRNA (UAS) - Lentiviral mouse Nup43 shRNA (UAS) plasmid
Recombinant Human Thymic Stromal Lymphopoietin/TSLP (R127A, R130A, C-10His)