Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Mouse (His)

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html

Purity

95.0

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 17.25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P45 NF-E2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62800R-BF405-01 20 µL

P45 NF-E2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
P45 NF-E2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62800R-BF405-02 100 µL

P45 NF-E2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Lentiviral human APEH shRNA (UAS) - Lentiviral human APEH shRNA (UAS) plasmid
GTR15103243 1 Vial

Lentiviral human APEH shRNA (UAS) - Lentiviral human APEH shRNA (UAS) plasmid

Sign In for Pricing
View Details
Prpsap2 (NM_057131) Rat Tagged Lenti ORF Clone
RR211579L4 10 µg

Prpsap2 (NM_057131) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SURF6 (NM_006753) Human Over-expression Lysate
LS006838-20ug 20 µg

SURF6 (NM_006753) Human Over-expression Lysate

Sign In for Pricing
View Details
PTPN11, Phosphorylated (Y580) (Protein Tyrosine Phosphatase Non-receptor Type 11, Noonan Syndrome 1, Protein Tyrosine Phosphatase 2C, BPTP3, CFC, MGC14433, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2) (MaxLight 750)
MBS6434183-01 0.1 mL

PTPN11, Phosphorylated (Y580) (Protein Tyrosine Phosphatase Non-receptor Type 11, Noonan Syndrome 1, Protein Tyrosine Phosphatase 2C, BPTP3, CFC, MGC14433, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2) (MaxLight 750)

Sign In for Pricing
View Details