Animal-Free CD70, Mouse (His)
The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html
Purity
95.0
Smiles
QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Molecular Formula
21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)
Molecular Weight
Approximately 17.25 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
SRGN (Serglycin, Hematopoietic Proteoglycan Core Protein, Platelet Proteoglycan Core Protein, P.PG, Secretory Granule Proteoglycan Core Protein, PRG, PRG1, FLJ12930, MGC9289) (MaxLight 650)
Integrin beta 1 (ITGB1) (NM_033668) Human Tagged ORF Clone
Lentiviral human MED11 shRNA (UAS) - Lentiviral human MED11 shRNA (UAS, iRFP) (25)