Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Mouse (His)

The CD70 protein is an important member of the tumor necrosis factor family and plays a crucial role in immune regulation and cellular responses.Its study enhances our understanding of immune regulation, providing potential applications for immunoassays and therapeutics.Animal-Free CD70 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCD70 protein, expressed by E.coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-mouse-his.html

Purity

95.0

Smiles

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

Molecular Formula

21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)

Molecular Weight

Approximately 17.25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpp4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3575103 1.0 µg DNA

Mpp4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TNIP2 (NM_024309) Human Tagged ORF Clone
RC201339 10 µg

TNIP2 (NM_024309) Human Tagged ORF Clone

Sign In for Pricing
View Details
ATAD2 Protein Vector (Human) (pPM-C-His)
PV002864 500 ng

ATAD2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ID2 (Inhibitor of DNA Binding 2, GIG8, ID2A, ID2H, MGC26389, bHLHb26) discontinued
211408-01 20 µL

ID2 (Inhibitor of DNA Binding 2, GIG8, ID2A, ID2H, MGC26389, bHLHb26) discontinued

Sign In for Pricing
View Details
ID2 (Inhibitor of DNA Binding 2, GIG8, ID2A, ID2H, MGC26389, bHLHb26) discontinued
211408-02 100 µL

ID2 (Inhibitor of DNA Binding 2, GIG8, ID2A, ID2H, MGC26389, bHLHb26) discontinued

Sign In for Pricing
View Details
KCNV2 Antibody, FITC conjugated
A64659-50UG 50 µg

KCNV2 Antibody, FITC conjugated

Sign In for Pricing
View Details