Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRTAM/CD355, Cynomolgus (HEK293, His)

CRTAM/CD355 Protein is an immunoglobulin-superfamily transmembrane protein, and is a member of nectin-like protein superfamily. CRTAM is also expressed on activated human NK cells, CD8+ T cells and a subset of CD4+ T cells. CRTAM takes part in cellular adhesion, polarity, and proliferation. CRTAM also regulates lymphocyte function, and promotes TCD8+ cell adhesion and retention within the lymph node. Furthermore, CRTAM can interact with Necl-2, and promotes cytotoxicity of NK cells and IFN-γ secretion of CD8+ T cells in vitro, and NK cell-mediated rejection of tumors expressing Necl-2 in vivo[1][2]sup>[3][4]. CRTAM/CD355 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRTAM/CD355 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crtam-protein-cynomolgus-hek-293-his.html

Smiles

SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTKANPQYLGLARKKSG

Molecular Formula

102125896 (Gene_ID) XP_005580021.1 (S18-G287) (Accession)

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF568 conjugate, 0.1mg/mL
BNC680950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details