Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dermatopontin/DPT, Mouse (HEK293, Fc)

The dermapontin (DPT) protein mediates adhesion by binding to integrins on the cell surface and serves as a communication link between dermal fibroblasts and the extracellular matrix. It enhances TGFB1 activity, inhibits cell proliferation, accelerates collagen fiber formation, and stabilizes its resistance to low-temperature dissociation. Dermatopontin/DPT Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Dermatopontin/DPT Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dermatopontin-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

QYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENV

Molecular Formula

56429 (Gene_ID) Q9QZZ6 (Q19-V201) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178E-01 50 Tests

APC Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details
APC Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178E-02 100 Tests

APC Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details
APC Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178E-03 2x 100 Tests

APC Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details
Human VPS37C activation kit by CRISPRa
GA110477 1 Kit

Human VPS37C activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Transcription Factor E3 Antibody
RC-5404-01 50 μL

Recombinant Transcription Factor E3 Antibody

Sign In for Pricing
View Details
Recombinant Transcription Factor E3 Antibody
RC-5404-02 100 µL

Recombinant Transcription Factor E3 Antibody

Sign In for Pricing
View Details