Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active)

Product Specifications

Product Name Alternative

Transforming growth factor beta-2; TGFB2; Polyergin; G-TSF; Glioblastoma-derived T-cell suppressor factor; Cetermin; BSC-1 cell growth inhibitor; TGF-beta-2

Abbreviation

Recombinant Human TGFB2 protein, partial (Active)

Gene Name

TGFB2

UniProt

P61812

Expression Region

303-414aa

Organism

Homo sapiens (Human)

Target Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Transforming growth factor beta-2 (TGF-β2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD) .

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells is 30-180pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 4 mM HCl

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)
MBS1444874-01 0.02 mg (E-Coli)

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)
MBS1444874-02 0.02 mg (Yeast)

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)
MBS1444874-03 0.1 mg (E-Coli)

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)
MBS1444874-04 0.1 mg (Yeast)

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)
MBS1444874-05 0.02 mg (Baculovirus)

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)
MBS1444874-06 0.02 mg (Mammalian-Cell)

Recombinant Coxiella burnetii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details