Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-3 complex subunit beta-2 (AP3B2), partial

Product Specifications

Product Name Alternative

(Adaptor protein complex AP-3 subunit beta-2) (Adaptor-related protein complex 3 subunit beta-2) (Beta-3B-adaptin) (Clathrin assembly protein complex 3 beta-2 large chain) (Neuron-specific vesicle coat protein beta-NAP)

Abbreviation

Recombinant Human AP3B2 protein, partial

Gene Name

AP3B2

UniProt

Q13367

Expression Region

973-1078aa

Organism

Homo sapiens (Human)

Target Sequence

APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 (AP-3) that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.0 kDa

References & Citations

"Autoimmune gait disturbance accompanying adaptor protein-3B2-IgG." Honorat J.A., Lopez-Chiriboga A.S., Kryzer T.J., Komorowski L., Scharf M., Hinson S.R., Lennon V.A., Pittock S.J., Klein C.J., McKeon A. Neurology 93:e954-e963 (2019)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV-2 Envelope Protein
OPPA00999-100UG 100 µg

HIV-2 Envelope Protein

Sign In for Pricing
View Details
Rat Presenilin 1 (PSEN1) ELISA Kit
MBS4502067-01 48 Tests

Rat Presenilin 1 (PSEN1) ELISA Kit

Sign In for Pricing
View Details
Rat Presenilin 1 (PSEN1) ELISA Kit
MBS4502067-02 96 Tests

Rat Presenilin 1 (PSEN1) ELISA Kit

Sign In for Pricing
View Details
Rat Presenilin 1 (PSEN1) ELISA Kit
MBS4502067-03 5x 96 Tests

Rat Presenilin 1 (PSEN1) ELISA Kit

Sign In for Pricing
View Details
Rat Presenilin 1 (PSEN1) ELISA Kit
MBS4502067-04 10x 96 Tests

Rat Presenilin 1 (PSEN1) ELISA Kit

Sign In for Pricing
View Details
Zcchc4 Rat Pre-designed siRNA Set A
HY-RS28495 1 Set

Zcchc4 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details