Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-21, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-21 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-21-protein-mouse-his.html

Purity

95.00

Smiles

MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (H18-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), 0.2mg/mL
BNUB2848-100 1x 100 µL

Fibronectin (Fn-3), 0.2mg/mL

Sign In for Pricing
View Details
p38 (MAPK14) pTyr182 Rabbit Polyclonal Antibody
AP02505PU-N 100 µL

p38 (MAPK14) pTyr182 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Forchlorfenuron
TRC-F691050-1G 1 g

Forchlorfenuron

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF594 conjugate, 0.1mg/mL
BNC942579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Forget-Me-NotTM EvaGreen® qPCR Master Mix (No ROX, No Template Buffer) (1000 reactions)
#99801-10mL 1x 10 mL

Forget-Me-NotTM EvaGreen® qPCR Master Mix (No ROX, No Template Buffer) (1000 reactions)

Sign In for Pricing
View Details
LCOR Mouse Monoclonal Antibody [Clone ID: OTI2F8]
CF807877 100 µg

LCOR Mouse Monoclonal Antibody [Clone ID: OTI2F8]

Sign In for Pricing
View Details