Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-21, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-21 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-21-protein-mouse-his.html

Purity

95.00

Smiles

MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (H18-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig C Reactive Protein (CRP) ELISA Kit
RDR-CRP-Gu-01 96 Tests

Guinea pig C Reactive Protein (CRP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig C Reactive Protein (CRP) ELISA Kit
RDR-CRP-Gu-02 48 Tests

Guinea pig C Reactive Protein (CRP) ELISA Kit

Sign In for Pricing
View Details
Cdk7 Mouse Gene Knockout Kit (CRISPR)
KN503049 1 Kit

Cdk7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHCHD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F3]
TA502372BM 100 µL

CHCHD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F3]

Sign In for Pricing
View Details
IRF5 (NM_001098631) Human Recombinant Protein
TP316039M 100 µg

IRF5 (NM_001098631) Human Recombinant Protein

Sign In for Pricing
View Details
Zcchc3 Mouse Gene Knockout Kit (CRISPR)
KN519664 1 Kit

Zcchc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details