Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-21, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-21 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-21-protein-mouse-his.html

Purity

95.00

Smiles

MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (H18-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD147 Antibody[HIM6]
E-AB-F1056D-01 20 Tests

PE Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
PE Anti-Human CD147 Antibody[HIM6]
E-AB-F1056D-02 100 Tests

PE Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
PE Anti-Human CD147 Antibody[HIM6]
E-AB-F1056D-03 2x 100 Tests

PE Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: AT3D11]
AM50038PU-S 50 µL

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: AT3D11]

Sign In for Pricing
View Details
Angiopoietin like 7 (ANGPTL7) (N-term) Rabbit Polyclonal Antibody
AP17106PU-N 400 µL

Angiopoietin like 7 (ANGPTL7) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL
BNC940957-500 1x 500 µL

Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details