Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-21, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. Animal-Free IL-21 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-21 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-21 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-21-protein-mouse-his.html

Purity

95.00

Smiles

MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (H18-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD9 Protein, C-His
bs-104644P-01 20 µg

Recombinant Human CD9 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD9 Protein, C-His
bs-104644P-02 50 µg

Recombinant Human CD9 Protein, C-His

Sign In for Pricing
View Details
Rabbit Anti-Equine Transferrin Receptor Protein 1 (TFRC) Polyclonal Antibody
VD12N127 1 Each

Rabbit Anti-Equine Transferrin Receptor Protein 1 (TFRC) Polyclonal Antibody

Sign In for Pricing
View Details
C1orf190 antibody - middle region
MBS3212627-01 0.1 mL

C1orf190 antibody - middle region

Sign In for Pricing
View Details
C1orf190 antibody - middle region
MBS3212627-02 5x 0.1 mL

C1orf190 antibody - middle region

Sign In for Pricing
View Details
Human PKD2L2 knockdown cell line
ABC-KD11645 1 Vial

Human PKD2L2 knockdown cell line

Sign In for Pricing
View Details