Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG4C, Human (His)

ATG4C Protein, Human (His) is a recombinant human Autophagy Related 4 Homolog C (Atg4C) expressed in E. coli with a His tag. Atg4C, a member of a family of cysteine proteinases, is a autophagy-regulating protease[1].

Product Specifications

Product Name Alternative

ATG4C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atg4c-protein-human-his.html

Purity

95.0

Smiles

MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLLHHHHHH

Molecular Formula

84938 (Gene_ID) Q96DT6 (M1-L458) (Accession)

Molecular Weight

Approximately 56 kDa

References & Citations

[1]Guillermo Mariño, et al. Tissue-specific autophagy alterations and increased tumorigenesis in mice deficient in Atg4C/autophagin-3. J Biol Chem. 2007 Jun 22;282 (25) :18573-18583.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)
PKSH032796-01 10 µg

Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)
PKSH032796-02 50 µg

Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)

Sign In for Pricing
View Details
PEBP1 Rabbit Monoclonal Antibody [Clone ID: 24GB860]
TA425043 100 µL

PEBP1 Rabbit Monoclonal Antibody [Clone ID: 24GB860]

Sign In for Pricing
View Details
Helicobacter pylori (HP/1335), 0.2mg/mL
BNUB1335-100 1x 100 µL

Helicobacter pylori (HP/1335), 0.2mg/mL

Sign In for Pricing
View Details
Proteinase K, 1ml
PC0712-1ml 1 mL

Proteinase K, 1ml

Sign In for Pricing
View Details
Anoctamin 3 (ANO3) Human Gene Knockout Kit (CRISPR)
KN423382 1 Kit

Anoctamin 3 (ANO3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details