Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Cynomolgus (HEK293, His)

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PD-L1 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

Molecular Formula

102145573 (Gene_ID) G7PSE7 (F19-T239) (Accession)

Molecular Weight

32-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type XVII (COL17) Magnetic Fluorescence Assay Kit
MBS2158366-01 96 Tests

Collagen Type XVII (COL17) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Collagen Type XVII (COL17) Magnetic Fluorescence Assay Kit
MBS2158366-02 5x 96 Tests

Collagen Type XVII (COL17) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Collagen Type XVII (COL17) Magnetic Fluorescence Assay Kit
MBS2158366-03 10x 96 Tests

Collagen Type XVII (COL17) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
CHIT1 CRISPRa sgRNA lentivector (set of three targets)(Human)
16071121 3x 1.0µg DNA

CHIT1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ZNF274 (Zinc Finger Protein 274, Neurotrophin Receptor-interacting Factor Homolog, Zf2, Zinc Finger Protein HFB101, Zinc Finger Protein with KRAB and SCAN Domains 19, Zinc Finger Protein zfp2, HFB101, SP2114, ZKSCAN19, ZSCAN51) (APC)
135669-APC 100 µL

ZNF274 (Zinc Finger Protein 274, Neurotrophin Receptor-interacting Factor Homolog, Zf2, Zinc Finger Protein HFB101, Zinc Finger Protein with KRAB and SCAN Domains 19, Zinc Finger Protein zfp2, HFB101, SP2114, ZKSCAN19, ZSCAN51) (APC)

Sign In for Pricing
View Details
Recombinant Mouse DDR2
Pr22929-01 10 µg

Recombinant Mouse DDR2

Sign In for Pricing
View Details