Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Fin bud initiation factor (fibin)

Product Specifications

Abbreviation

Recombinant Zebrafish fibin protein

Gene Name

Fibin

UniProt

A1IGX5

Expression Region

24-210aa

Organism

Danio rerio (Zebrafish) (Brachydanio rerio)

Target Sequence

FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), 1mg/mL
BNUM0225-50 1x 50 µL

Major Vault Protein (MVP) (1032), 1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL
BNC741471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF640R conjugate, 0.1mg/mL
BNC402424-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF594 conjugate, 0.1mg/mL
BNC940906-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details